Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Antimicrobial and Related Peptides  >>  5-FAM-LC-LL-37

Product Name 5 - FAM - LC - LL - 37
5 - FAM - LC - [LL-37, 37 aa]
Size 0.1 mg
Catalog # AS-63694
US$ $132
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 4964.9
Sequence
(One-Letter Code)
5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence
(Three-Letter Code)
5 - FAM - LC - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH
Product Citations Swidergall, M. et al. (2013). Candida albicans mucin Msb2 Is a broad-tange protectant against antimicrobial peptides. Antimicrob Agents Chemother 57, 3917. doi: 10.1128/AAC.00862-13.
     
  < Back