Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Endothelins  >>  Big Endothelin-1 (1-38), human

Product Name Big Endothelin - 1 (1 - 38), human
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15 and 3 - 11)
Size 1 mg
Catalog # 62946-1
US$ $605
Purity % Peak Area By HPLC ≥ 95%
Description

Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides.

Storage -20C
References Fecteau; M. et al. Hypertension 46, 87 (2005).
Molecular Weight 4283.0
Sequence
(One-Letter Code)
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11)
Sequence
(Three-Letter Code)
H - Cys - Ser - Cys - Ser - Ser - Leu - Met - Asp - Lys - Glu - Cys - Val - Tyr - Phe - Cys - His - Leu - Asp - Ile - Ile - Trp - Val - Asn - Thr - Pro - Glu - His - Val - Val - Pro - Tyr - Gly - Leu - Gly - Ser - Pro - Arg - Ser - OH (Disulfide bridge: 1 - 15 and 3 - 11)
     
  < Back