Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Antimicrobial and Related Peptides  >>  LL-37, scrambled

Product Name LL - 37, scrambled
Size 1 mg
Catalog # 63708
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Storage -20°C
Molecular Weight 4493.3
Sequence
(One-Letter Code)
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Product Citations McQuade, R. et al. (2012). Clostridium difficile clinical isolates exhibit variable susceptibility and proteome alterations upon exposure to mammalian cationic antimicrobial peptides. Anaerobe 286, 18890. doi: 10.1074/jbc.M110.206110 .
Campbell, GR. And SA. Spector (2011). Hormonally active vitamin D3 (1α,25-Dihydroxycholecalciferol) triggers autophagy in human macrophages that inhibits HIV-1 infection. JBC 286, 18890. doi: 10.1074/jbc.M110.206110 .
Soscia, S. et al. (2010). The Alzheimer’s Disease-Associated Amyloid b-Protein Is an Antimicrobial Peptide. PLoS One doi:10.1371/journal.pone.0009505.
     
  < Back