Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (11-42), Human

Product Name Beta - Amyloid (11 - 42), Human
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # 63317
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Näslund, J. et al. PNAS USA 91, 8378 (1994).
Molecular Weight 3335.9
Sequence
(One-Letter Code)
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back