Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (3-42), Human

Product Name Beta - Amyloid (3 - 42), Human
EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 0.1 mg
Catalog # 63715-01
US$ $93
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20°C
Molecular Weight 4327.9
Sequence
(One-Letter Code)
EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Wirths, O. et al. (2010). Pyroglutamate Abeta pathology in APP/PS1KI mice, sporadic and familial Alzheimer’s disease cases. J Neural Transmission 117, 85.
     
  < Back