Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Arg6]-beta-Amyloid (1-42), English Mutation

Product Name [Arg6] - beta - Amyloid (1 - 42), English Mutation
Size 0.5 mg
Catalog # 63323
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Hori, Y. et al. J. Biol. Chem. 282, 4916 (2007).
Molecular Weight 4533.2
Sequence
(One-Letter Code)
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - Arg - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back