Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Arg6]-beta-Amyloid (1-42), English Mutation, Human

Product Name [Arg6] - beta - Amyloid (1 - 42), English Mutation, Human
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 0.5 mg
Catalog # AS-63323
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Hori, Y. et al. J. Biol. Chem. 282, 4916 (2007).
Molecular Weight 4533.2
Sequence
(One-Letter Code)
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - Arg - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back