Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Leu33]-beta-Amyloid (1-40), Human

Product Name [Leu33] - beta - Amyloid (1 - 40), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIILLMVGGVV
Size 0.1 mg
Catalog # 62830-01
US$ $93
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 40 beta amyloid peptide with the substitution of Gly33 to Leu33. This peptide was used in conformational studies associated with Alzheimers diseases. Large and hydrophobic leucine side chain would effectively eliminate the surface groove created by Gly33. This mutant peptide forms aggregates. There is no indication of either protofibril or fibril formation.

Storage -20C
References Sato, T. et al. Biochem.45, 5509 (2006); Kim, S. et al. PNAS102, 14278 (2005).
Molecular Weight 4386.0
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIILLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Leu - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back