This is amino acids 1 to 40 beta amyloid peptide with the substitution of Gly33 to Leu33. This peptide was used in conformational studies associated with Alzheimers diseases. Large and hydrophobic leucine side chain would effectively eliminate the surface groove created by Gly33. This mutant peptide forms aggregates. There is no indication of either protofibril or fibril formation.
Storage
-20°C
References
Sato, T. et al. Biochem.45, 5509 (2006); Kim, S. et al. PNAS102, 14278 (2005).
Molecular Weight
4386.0
Sequence (One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIILLMVGGVV
Sequence (Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Leu - Leu - Met - Val - Gly - Gly - Val - Val - OH
