Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)  >>  Amyloid Precursor Protein, (APP) (721-770)

Product Name Amyloid Precursor Protein, (APP) (721 - 770)
Size 0.5 mg
Catalog # 63322
US$ $357
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 721 to 770 fragment of the amyloid precursor protein resulting from the g-secretase cleavage of the C-terminus of beta-amyloid precursor protein (APP) at Leu720-Val721. This peptide is also known as CTF50-99. The mutation at Leu723 (L723P) causes familial Alzheimer’s disease.

Storage -20°C
References Gu, Y., et al. J. Biol. Chem. 276, 35235 (2001); Kwok, J. et al. Ann. Neurol. 47, 249 (2000).
Molecular Weight 5910.7
Sequence
(One-Letter Code)
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Sequence
(Three-Letter Code)
H - Val - Met - Leu - Lys - Lys - Lys - Gln - Tyr - Thr - Ser - Ile - His - His - Gly - Val - Val - Glu - Val - Asp - Ala - Ala - Val - Thr - Pro - Glu - Glu - Arg - His - Leu - Ser - Lys - Met - Gln - Gln - Asn - Gly - Tyr - Glu - Asn - Pro - Thr - Tyr - Lys - Phe - Phe - Glu - Gln - Met - Gln - Asn - OH
     
  < Back