Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Gln22, Asn23]-beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa double mutation

Product Name [Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation
Size 0.5 mg
Catalog # 62146
US$ $220
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Van Nostrand, W. et al. Ann. N.Y. Acad. Sci. 977, 258 (2002).
Molecular Weight 4327.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Gln - Asn - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back