Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Gln22]-beta-Amyloid (1-42), E22Q Dutch Mutation

Product Name [Gln22] - beta - Amyloid (1 - 42), E22Q Dutch Mutation
Size 0.5 mg
Catalog # 62142
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is a naturally occurring mutant form of the wild type (WT) beta-Amyloid 1 to 42 peptide. The E22Q "Dutch" mutant, also known as HCHWA-D, is caused by a point mutation in the beta-Amyloid encoding gene, with Glu replaced by Gln at position 22. Dutch E22Q mutation in beta-Amyloid causes familial cerebrovascular amyloidosis with abundant diffused amyloid plaque deposits. E22Q mutant and WT peptides are both stable in "collapsed coil" conformations. The E22Q fibrils are more toxic for vascular cells than the WT fibrils.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Massi, F. and J. Straub Biophys. J. 81, 697 (2001); Muñoz, F. et al. J. Neurosci. 22, 3081 (2002); Davis, J. et al. J. Biol. Chem. 279, 20296 (2004).
Molecular Weight 4513.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Gln - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back