Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Exendins  >>  Exendin (5-39)

Product Name Exendin (5 - 39)
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 1 mg
Catalog # 63898
US$ $242
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 3806.3
Sequence
(One-Letter Code)
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
H - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back