Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Tag Peptides  >>  3 x Hemagglutinin (HA) Tag

Product Name 3 x Hemagglutinin (HA) Tag
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Size 1 mg
Catalog # 63764
US$ $347
Purity % Peak Area By HPLC ≥ 95%
Description

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Kang, Y. et al. J. Biol. Chem. 281, 19019 (2006).
Molecular Weight 4372.7
Sequence
(One-Letter Code)
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Sequence
(Three-Letter Code)
H - Met - Glu - Tyr - Pro - Tyr - Asp - Val - Pro - Asp - Tyr - Ala - Ala - Glu - Tyr - Pro - Tyr - Asp - Val - Pro - Asp - Tyr - Ala - Ala - Glu - Tyr - Pro - Tyr - Asp - Val - Pro - Asp - Tyr - Ala - Ala - Lys - Leu - Glu - OH
     
  < Back