Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40) (S26C) Dimer, Human

Product Name Beta - Amyloid (1 - 40) (S26C) Dimer, Human
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV (dimer)
Size 0.5 mg
Catalog # 64130-05
US$ $242
Purity % Peak Area By HPLC ≥ 95%
Description

This is dimerization of the S26C beta-Amyloid (1-40) peptide.

Detailed Information Datasheet
Storage -20C
Molecular Weight 8690.8
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV (dimer)
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Cys - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH (dimer)
     
  < Back