Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Cys20]-beta-Amyloid (1-40), Human

Product Name [Cys20] - beta - Amyloid (1 - 40), Human
DAEFRHDSGYEVHHQKLVFCAEDVGSNKGAIIGLMVGGVV
Size 0.5 mg
Catalog # 63895
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 10 to 35 fragment of beta-amyloid peptide with phenylalanine 20 substituted with cysteine.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4285.8
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFCAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Cys - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back