Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40), sodium salt, Human

Product Name Beta - Amyloid (1 - 40), sodium salt, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Na salt
Size 1 mg
Catalog # 64153-1
US$ $363
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide prepared by neutralizing the TFA salt form of A (1-40) with a diluted sodium hydroxide solution has superior solubility and fibrillogenesis properties, and the fibrils are equally neurotoxic.

Storage -20C
References Kaneko, I. et al. Nippon Yakurigaku Zasshi. 115, 67 (2000).
Molecular Weight 4351.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Na salt
Sequence
(Three-Letter Code)
Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val, Na salt
     
  < Back