Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Beta-Amyloid (1-40), AMCA-LC-labeled

Product Name	Beta - Amyloid (1 - 40), AMCA - LC - labeled
Size	0.1 mg
Catalog #	60487-01
US$	$181
Purity	% Peak Area By HPLC ≥ 95%
Description	This is a fluorescent (AMCA)-labeled ß-Amyloid peptide, Abs/Em=354/442 nm.
Storage	-20°C
Molecular Weight	4676.3
Sequence (One-Letter Code)	AMCA-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (Three-Letter Code)	AMCA - LC - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH