Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (1-40), AMCA-LC-labeled, Human

Product Name Beta - Amyloid (1 - 40), AMCA - LC - labeled, Human
AMCA - LC - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # AS-60487-01
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (AMCA)-labeled -Amyloid peptide, Abs/Em=354/442 nm.

Storage -20C
Molecular Weight 4676.3
Sequence
(One-Letter Code)
AMCA-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
AMCA - LC - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Anderson, VL. & WW. Webb (2011). Transmission electron microscopy characterization of fluorescently labelled amyloid β 1-40 and α-synuclein aggregates. BMC Biotechnol 11, 125. doi:10.1186/1472-6750-11-125.
     
  < Back