Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (1-40), FAM-labeled

Product Name Beta - Amyloid (1 - 40), FAM - labeled
Size 0.1 mg
Catalog # 23514-01
US$ $132
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Detailed Information Datasheet
Storage -20°C
References Ref: Prior, R. et al. Am. J. Pathol. 148, 1749 (1996).
Molecular Weight 4688.2
Sequence
(One-Letter Code)
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
FAM - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Song, E. et al. (2011). Mixed dimers of insulin degrading enzyme reveal a Cis activation mechanism. J Biol Chem doi: 10.1074/jbc.M110.191668.
Behl, M. et al. (2010). Lead-induced accumulation of β-amyloid in the choroid plexus: Role of low density lipoprotein receptor protein-1 and protein kinase C. NeuroToxicol doi:10.1016/j.neuro.2010.05.004.
Huang, WC. et al. (2009). Enlargement of Aβ aggregates through chemokine-dependent microglial clustering. Neurosci. Res. 63, 280.
Wakabayashi, M. et al. (2007). Formation of Amyloids by Aβ-(1–42) on NGF-differentiated PC12 Cells: Roles of Gangliosides and Cholesterol. J. Mol. Biol. 371, 924.
     
  < Back