Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled, Human

Product Name Beta - Amyloid (1 - 40), HiLyte™ Fluor 555 - labeled, Human
HiLyte™ Fluor 555 - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # 60492-01
US$ $220
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (HiLyte™ Fluor 555)-labeled ß-Amyloid peptide, Abs/Em=551/567 nm. HiLyte™ Fluor 555 labeled Aß (1-40) is more photostable than Cy3-labeled A? (1-40).

Detailed Information Datasheet
Storage -20°C
Molecular Weight 5199
Sequence
(One-Letter Code)
HiLyte™ Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
Hilyte™ Fluor 555 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Iliff, J. et al. (2012). Paravascular pathway facilitates CSF flow through the brain parenchyma and the clearance of interstitial solutes, including amyloid β. Sci Transl Med 4, 147ra111. doi: 10.1126/scitranslmed.3003748.
Nazer, B. et al. (2008). LRP promotes endocytosis and degradation, but not transcytosis, of the amyloid-β peptide in a blood–brain barrier in vitro model. Neurobio. Dis. 30, 94.
     
  < Back