Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (11-42), HiLyte Fluor™ 488-labeled

Product Name Beta - Amyloid (11 - 42), HiLyte Fluor™ 488 - labeled
Size 0.1 mg
Catalog # 63327
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte Fluor™ 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. Hilyte Fluor™ 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Huse, J. T. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002).
Molecular Weight 3692.3
Sequence
(One-Letter Code)
HiLyte Fluor™ 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
HiLyte Fluor™ 488 - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Hickman, S. et al. J Neurosci 28, 8354 (2008).
     
  < Back