Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  [Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4

Product Name [Cys(HiLyte™ Fluor 647 C2 maleimide)] - Exendin - 4
C(HiLyteFluor 647 C2 maleimide) - HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 50 ug
Catalog # AS-63714
US$ $115
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is HiLyte Fluor 647 labeled Extendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide C-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.

Storage -20°C
References Eng, J. et al. J Biol Chem 267, 7402 (1992)
Greig, NH. et al. Diabetolog 42, 45 (1999)
Göke R. et al. J Biol Chem 268, 19650 (1993)
Molecular Weight 5486.3
Sequence
(One-Letter Code)
C(HiLyte™ Fluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
H - Cys(Hilyte™ Fluor 647 C2 maleimide) - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back