Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  [Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4

Product Name [Cys(HiLyte™ Fluor 647 C2 maleimide)] - Exendin - 4
C(HiLyteFluor 647 C2 maleimide) - HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 50 ug
Catalog # 63714
US$ $115
Purity % Peak Area By HPLC ≥ 95%
Storage -20°C
Molecular Weight 5486.3
Sequence
(One-Letter Code)
C(HiLyte™ Fluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
H - Cys(Hilyte™ Fluor 647 C2 maleimide) - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back