Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Fluorescent Labeled Peptides  >>  Galanin, human, FAM-labeled

Product Name Galanin, human, FAM - labeled
Size 1 mg
Catalog # 23603
US$ $423
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (FAM)-labeled Galanin peptide, Abs/Em=494/521 nm.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 3515.8
Sequence
(One-Letter Code)
FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Sequence
(Three-Letter Code)
FAM - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - OH
Product Citations Mazarati, A. et al. (2006). Regulation of Kindling Epileptogenesis by Hippocampal Galanin Type 1 and Type 2 Receptors: The Effects of Subtype-Selective Agonists and the Role of G-Protein-Mediated Signaling. J Pharmacol Exp Ther 318, 700.
     
  < Back