Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)

Product Name FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)
DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Size 0.5 mg
Catalog # 63728-05
US$ $1149
Purity % Peak Area By HPLC ≥ 95%
Description

FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.

Storage -20C
References K. Kokame, et al. Br. J. Haematol., 129, 93-100 (2005)
Molecular Weight 8314.3
Sequence
(One-Letter Code)
DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Sequence
(Three-Letter Code)
H - Asp - Arg - Glu - Dap(Nma) - Ala - Pro - Asn - Leu - Val - Tyr - Met - Val - Thr - Gly - Dap(Dnp) - Pro - Ala - Ser - Asp - Glu - Ile - Lys - Arg - Leu - Pro - Gly - Asp - Ile - Gln - Val - Val - Pro - Ile - Gly - Val - Gly - Pro - Asn - Ala - Asn - Val - Gln - Glu - Leu - Glu - Arg - Ile - Gly - Trp - Pro - Asn - Ala - Pro - Ile - Leu - Ile - Gln - Asp - Phe - Glu - Thr - Leu - Pro - Arg - Glu - Ala - Pro - Asp - Leu - Val - Leu - Gln - Arg - OH
     
  < Back