Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-28) and Related Peptides  >>  Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Human

Product Name Beta - Amyloid (1 - 28) - Lys(Biotin) - NH2, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNK - K(Biotin) - NH2
Size 0.5 mg
Catalog # AS-62465
US$ $242
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 3616
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Lys(Biotin) - NH2
     
  < Back