Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Cys(HiLyte™ Fluor 555 C2 maleimide)]-beta-Amyloid (1-40), Human

Product Name [Cys(HiLyte™ Fluor 555 C2 maleimide)] - beta - Amyloid (1 - 40), Human
C(HiLyte™ Fluor 555 C2 maleimide) - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # 64415
US$ $225
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 5495.3
Sequence
(One-Letter Code)
C(HiLyte™ Fluor 555 C2 maleimide)-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
Cys(Hilyte™ Fluor 555 C2 maleimide) - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Spectral Properties Abs/Em=551/567 nm
     
  < Back