Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Protein Phosphorylation Related Peptides  >>  PDKtide

Product Name PDKtide
[protein fragment, 39 aa]
Size 1 mg
Catalog # AS-64225
US$ $374
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).

Storage -20C
References Biondi, R.M. et al. EMBO J. 19, 979 (2000).; Komander, D. et al. Structure 12, 215 (2004).
Molecular Weight 4771.4
Sequence
(One-Letter Code)
[protein fragment, 39 aa]
Sequence
(Three-Letter Code)
H - Lys - Thr - Phe - Cys - Gly - Thr - Pro - Glu - Tyr - Leu - Ala - Pro - Glu - Val - Arg - Arg - Glu - Pro - Arg - Ile - Leu - Ser - Glu - Glu - Glu - Gln - Glu - Met - Phe - Arg - Asp - Phe - Asp - Tyr - Ile - Ala - Asp - Trp - Cys - OH
     
  < Back