Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

PDKtide

Product Name	PDKtide
Size	1 mg
Catalog #	64225
US$	$374
Purity	% Peak Area By HPLC ≥ 95%
Description	This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).
Storage	-20°C
References	Biondi, R.M. et al. EMBO J. 19, 979 (2000).; Komander, D. et al. Structure 12, 215 (2004).
Molecular Weight	4771.4
Sequence (One-Letter Code)	KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
Sequence (Three-Letter Code)	H - Lys - Thr - Phe - Cys - Gly - Thr - Pro - Glu - Tyr - Leu - Ala - Pro - Glu - Val - Arg - Arg - Glu - Pro - Arg - Ile - Leu - Ser - Glu - Glu - Glu - Gln - Glu - Met - Phe - Arg - Asp - Phe - Asp - Tyr - Ile - Ala - Asp - Trp - Cys - OH