Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Neuropeptides  >>  Urocotin III; Stresscopin (SCP) (3-40), mouse

Product Name Urocotin III; Stresscopin (SCP) (3 - 40), mouse
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI - NH2
Size 0.5 mg
Catalog # 64393-05
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Description

Urocortin III is a 38 amino acid peptide that is a member of the Corticotropin-Releasing Factor (CRF) family of peptides. Studies show that Urocortin III is highly selective for the Corticotropin-Releasing Factor 2 (CRF2) receptor and does not show affinity for the CRF binding protein.

Storage -20C
Molecular Weight 4173
Sequence
(One-Letter Code)
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Sequence
(Three-Letter Code)
H - Phe - Thr - Leu - Ser - Leu - Asp - Val - Pro - Thr - Asn - Ile - Met - Asn - Ile - Leu - Phe - Asn - Ile - Asp - Lys - Ala - Lys - Asn - Leu - Arg - Ala - Lys - Ala - Ala - Ala - Asn - Ala - Gln - Leu - Met - Ala - Gln - Ile - NH2
     
  < Back