Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Met]-beta-Amyloid (1-42), 5-TAMRA labeled, Human

Product Name [Met] - beta - Amyloid (1 - 42), 5 - TAMRA labeled, Human
5 - TAMRA - MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 0.1 mg
Catalog # AS-64519
US$ $259
Purity % Peak Area By HPLC ≥ 95%
Description

This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 5057.8
Sequence
(One-Letter Code)
5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
5 - TAMRA - Met - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back