Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  OVA Peptides  >>  OVA (241-270)

Product Name OVA (241 - 270)
SMLVLLPDEVSGLEQLESIINFEKLTEWTS
Size 1 mg
Catalog # AS-64525
US$ $209
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).

Storage -20C
References Mareeva, T. et al. J Biol Chem 279, 44243 (2004).
Molecular Weight 3421.9
Sequence
(One-Letter Code)
SMLVLLPDEVSGLEQLESIINFEKLTEWTS
Sequence
(Three-Letter Code)
H - Ser - Met - Leu - Val - Leu - Leu - Pro - Asp - Glu - Val - Ser - Gly - Leu - Glu - Gln - Leu - Glu - Ser - Ile - Ile - Asn - Phe - Glu - Lys - Leu - Thr - Glu - Trp - Thr - Ser - OH
     
  < Back