Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Calcitonin Related Peptides  >>  β-CGRP, human

Product Name β - CGRP, human
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
Size 1 mg
Catalog # 64563-1
US$ $330
Purity % Peak Area By HPLC ≥ 95%
Description

This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.

Storage -20C
References Bose, C. et al. Biochem J 280, 147 (1991).
Molecular Weight 3793.4
Sequence
(One-Letter Code)
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
Sequence
(Three-Letter Code)
H - Ala - Cys - Asn - Thr - Ala - Thr - Cys - Val - Thr - His - Arg - Leu - Ala - Gly - Leu - Leu - Ser - Arg - Ser - Gly - Gly - Met - Val - Lys - Ser - Asn - Phe - Val - Pro - Thr - Asn - Val - Gly - Ser - Lys - Ala - Phe - NH2 (Disulfide bridge:2 - 7)
     
  < Back