This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Storage
-20°C
References
Kovaks, E. et al. J Biol Chem285, 1799 (2010).
Molecular Weight
3616.4
Sequence (One-Letter Code)
KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Sequence (Three-Letter Code)
H - Lys - Ser - Lys - Lys - Ala - Val - Trp - His - Lys - Leu - Leu - Ser - Lys - Gln - Arg - Arg - Arg - Ala - Val - Val - Ala - Cys - Phe - Arg - Met - Thr - Pro - Leu - Tyr - Asn - OH
