Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cardiac Peptides  >>  RYR2 (2460-2495)

Product Name RYR2 (2460 - 2495)
GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Size 1 mg
Catalog # 64769
US$ $297
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.

Storage -20C
References Jiang, D. et al. Proc Natl Acad Sci U S A 101, 35 (2004).
Molecular Weight 4103.9
Sequence
(One-Letter Code)
GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Sequence
(Three-Letter Code)
H - Gly - Phe - Cys - Pro - Asp - His - Lys - Ala - Ala - Met - Val - Leu - Phe - Leu - Asp - Arg - Val - Tyr - Gly - Ile - Glu - Val - Gln - Asp - Phe - Leu - Leu - His - Leu - Leu - Glu - Val - Gly - Phe - Leu - Pro - OH
     
  < Back