This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Storage
-20°C
References
Wadia, J. et al. Nature Med10, 310 (2004).
Molecular Weight
3433
Sequence (One-Letter Code)
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Sequence (Three-Letter Code)
H - Arg - Arg - Arg - Gln - Arg - Arg - Lys - Lys - Arg - Gly - Gly - Asp - Ile - Met - Gly - Glu - Trp - Gly - Asn - Glu - Ile - Phe - Gly - Ala - Ile - Ala - Gly - Phe - Leu - Gly - OH
