Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Protein Phosphorylation Related Peptides  >>  PDKtide, biotin labeled

Product Name PDKtide, biotin labeled
Size 1 mg
Catalog # 64224
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

This 39-mer peptide is a biotinylated substrate for phosphatidylinositide-dependent kinase 1 (PDK1). Biotin is linked to the N-terminus of the peptide through an LC (6-carbon linker). PDK1 has a C-terminal pleckstrin homology domain that aims at phosphoinositide lipids on the plasma membrane. It is central to the activating protein kinase B, a protein that mediates biological responses to insulin and growth factors.

Storage -20°C
References Berggreen, C. et al. Am J Physiol Endocrinol Metab 296, 635 (2009); Scheid, M. et al. Mol Cell Biol 25, 6 (2005).
Molecular Weight 5110.9
Sequence
(One-Letter Code)
Biotin-Ahx[protein fragment, 39 aa]
Sequence
(Three-Letter Code)
Biotin - Ahx - Lys - Thr - Phe - Cys - Gly - Thr - Pro - Glu - Tyr - Leu - Ala - Pro - Glu - Val - Arg - Arg - Glu - Pro - Arg - Ile - Leu - Ser - Glu - Glu - Glu - Gln - Glu - Met - Phe - Arg - Asp - Phe - Asp - Tyr - Ile - Ala - Asp - Trp - Cys - OH
     
  < Back