Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Glucagon-Like Peptides  >>  GLP-1(9-36), amide, human

Product Name GLP - 1(9 - 36), amide, human
Size 1 mg
Catalog # 65070
US$ $203
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is residues 9-36 of glucagon-like peptide 1 (GLP-1). GLP-1 is a neuroendocrine hormone derived from preproglucagon secreted by intestinal L cells. GLP-1 stimulates glucose-dependent insulin secretion and inhibits glucagon secretion.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References John, H. et a. Eur J Med Res 13, 73 (2008).
Molecular Weight 3089.5
Sequence
(One-Letter Code)
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(Three-Letter Code)
H - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
     
  < Back