Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Pro19]-beta-Amyloid (1-42); F19P beta-Amyloid (1-42), Human

Product Name [Pro19] - beta - Amyloid (1 - 42); F19P beta - Amyloid (1 - 42), Human
DAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # AS-65178
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is beta-amyloid (1-42) with substitution of Phe19 to Pro. This substitution inhibits amyloid fibril formation, which is implicated in neurodegenerative diseases such as Alzheimer’s.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Bernstein, S. et al. J Am Chem Soc 127, 2075 (2005); O’Nuallain, B. and R Wetzel. Proc Natl Acad Sci USA 99, 1485 (2002).
Molecular Weight 4464.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Pro - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back