Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Pro19]-beta-Amyloid (1-42); F19P beta-Amyloid (1-42)
Product Name [Pro19] - beta - Amyloid (1 - 42); F19P beta - Amyloid (1 - 42)
Size 1 mg
Catalog # 65178
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is beta-amyloid (1-42) with substitution of Phe19 to Pro. This substitution inhibits amyloid fibril formation, which is implicated in neurodegenerative diseases such as Alzheimer’s.
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Bernstein, S. et al. J Am Chem Soc 127, 2075 (2005); O’Nuallain, B. and R Wetzel. Proc Natl Acad Sci USA 99, 1485 (2002).
Molecular Weight 4464.1
Sequence
(One-Letter Code)		 DAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)		 H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Pro - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions