Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Ala37]-beta-Amyloid (1-42); G37A beta-Amyloid (1-42), Human

Product Name [Ala37] - beta - Amyloid (1 - 42); G37A beta - Amyloid (1 - 42), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVAGVVIA
Size 1 mg
Catalog # 65168
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is derived from beta-amyloid (1-42). Gly37 has been substituted to Ala in this peptide. This peptide is used to study the effect of G37A mutation on dimerization strength for the formation of Ab species.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Munter, LM. et al. EMBO J 26, 1702 (2006).
Molecular Weight 4528.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVAGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Ala - Gly - Val - Val - Ile - Ala - OH
     
  < Back