Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Cys20]-beta-Amyloid (1-42)
Product Name [Cys20] - beta - Amyloid (1 - 42)
Size 1 mg
Catalog # 65175
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

This is beta-amyloid (1-42) with substitution of Phe20 to Cys. Cysteine substitutions are used to study the structure and stabilization of amyloid fibrils.
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Shivaprasad, S. and R. Wetzel J Biol Chem 281, 993 (2006).
Molecular Weight 4470.1
Sequence
(One-Letter Code)		 DAEFRHDSGYEVHHQKLVFCAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)		 H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Cys - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions