Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Apolipoprotein Peptides  >>  Apolipoprotein E (131-169)

Product Name Apolipoprotein E (131 - 169)
Size 1 mg
Catalog # 65188
US$ $335
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is derived from apolipoprotein E (apoE) residues 131-169. ApoE is primarily synthesized by the liver but can also be found in the spleen, kidney, adrenals, gonads, and brain. It is a ligand for low-density lipoprotein receptors and is involved in cholesterol and lipid transport and metabolism. ApoE is associated with peripheral nerve injury and regeneration, immunoregulation, and regulation of cell growth and differentiation. It has also been implicated in the pathogenesis of Alzheimer’s disease (AD), arteriosclerosis, and familial type III hyperlipoproteinemia.

Storage -20°C
References Davignon, J. et al. Arterioscler Thromb Vasc Biol 8, 1 (1988); Mahley, RW. Science 240, 622 (1988).
Molecular Weight 4633.5
Sequence
(One-Letter Code)
GRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD
Sequence
(Three-Letter Code)
H - Gly - Arg - Leu - Val - Gln - Tyr - Arg - Gly - Glu - Val - Gln - Ala - Met - Leu - Gly - Gln - Ser - Thr - Glu - Glu - Leu - Arg - Val - Arg - Leu - Ala - Ser - His - Leu - Arg - Lys - Leu - Arg - Lys - Arg - Leu - Leu - Arg - Asp - OH
     
  < Back