Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Histone H3 (1-50)

Product Name	Histone H3 (1 - 50)
Size	0.25 mg
Catalog #	65367-025
US$	$560
Purity	% Peak Area By HPLC ≥ 95%
Description	This peptide is histone H3 (1-50).
Storage	-20°C
Molecular Weight	5341.2
Sequence (One-Letter Code)	ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE
Sequence (Three-Letter Code)	H - Ala - Arg - Thr - Lys - Gln - Thr - Ala - Arg - Lys - Ser - Thr - Gly - Gly - Lys - Ala - Pro - Arg - Lys - Gln - Leu - Ala - Thr - Lys - Ala - Ala - Arg - Lys - Ser - Ala - Pro - Ala - Thr - Gly - Gly - Val - Lys - Lys - Pro - His - Arg - Tyr - Arg - Pro - Gly - Thr - Val - Ala - Leu - Arg - Glu - OH