Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Histones  >  Histone H3 Peptides  >>  Histone H3 (1-55), biotin-labeled, acetylated

Product Name Histone H3 (1 - 55), biotin - labeled, acetylated
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ - K(LC - Biotin) - NH2
Size 0.25 mg
Catalog # AS-65362-025
US$ $600
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is histone H3 (1-55) with acetylation at its N-terminus and an additional Lys residue on its C-terminus. A 6-carbon LC linker and biotin are conjugated to the epsilon side chain of this Lys. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.

Storage -20C
Molecular Weight 6566.8
Sequence
(One-Letter Code)
Ac-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ-K(LC-Biotin)-NH2
Sequence
(Three-Letter Code)
Ac - Ala - Arg - Thr - Lys - Gln - Thr - Ala - Arg - Lys - Ser - Thr - Gly - Gly - Lys - Ala - Pro - Arg - Lys - Gln - Leu - Ala - Thr - Lys - Ala - Ala - Arg - Lys - Ser - Ala - Pro - Ala - Thr - Gly - Gly - Val - Lys - Lys - Pro - His - Arg - Tyr - Arg - Pro - Gly - Thr - Val - Ala - Leu - Arg - Glu - Ile - Arg - Arg - Tyr - Gln - Lys(LC - Biotin) - NH2
     
  < Back