Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Osteocalcin Fragments  >>  Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Product Name Des - gamma - carboxylated Osteocalcin/Bone Gla Protein
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23 - 29)
Size 0.25 mg
Catalog # 65307-025
US$ $175
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.

Storage -20C
References Houben, R. et al. Biochem J 364, 323 (2002); Ducy, P. et al. Nature 382, 448 (1996); Benton, ME. et al. Biochem 37, 13262 (1995); Engelke, J. et al. Biochim Biophys Acta 1078, 31 (1991); Ulrich, M. et al. Biochim Biophys Acta 830, 105 (1985).
Molecular Weight 5797.5
Sequence
(One-Letter Code)
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
Sequence
(Three-Letter Code)
H - Tyr - Leu - Tyr - Gln - Trp - Leu - Gly - Ala - Pro - Val - Pro - Tyr - Pro - Asp - Pro - Leu - Glu - Pro - Arg - Arg - Glu - Val - Cys - Glu - Leu - Asn - Pro - Asp - Cys - Asp - Glu - Leu - Ala - Asp - His - Ile - Gly - Phe - Gln - Glu - Ala - Tyr - Arg - Arg - Phe - Tyr - Gly - Pro - Val - OH (Disulfide bridge:C23 - 29)
     
  < Back