Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Osteocalcin Fragments  >>  Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Product Name Des - gamma - carboxylated Osteocalcin/Bone Gla Protein
Size 0.25 mg
Catalog # 65307-025
US$ $175
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.

Storage -20°C
References Houben, R. et al. Biochem J 364, 323 (2002); Ducy, P. et al. Nature 382, 448 (1996); Benton, ME. et al. Biochem 37, 13262 (1995); Engelke, J. et al. Biochim Biophys Acta 1078, 31 (1991); Ulrich, M. et al. Biochim Biophys Acta 830, 105 (1985).
Molecular Weight 5797.5
Sequence
(One-Letter Code)
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
Sequence
(Three-Letter Code)
H - Tyr - Leu - Tyr - Gln - Trp - Leu - Gly - Ala - Pro - Val - Pro - Tyr - Pro - Asp - Pro - Leu - Glu - Pro - Arg - Arg - Glu - Val - Cys - Glu - Leu - Asn - Pro - Asp - Cys - Asp - Glu - Leu - Ala - Asp - His - Ile - Gly - Phe - Gln - Glu - Ala - Tyr - Arg - Arg - Phe - Tyr - Gly - Pro - Val - OH (Disulfide bridge:C23 - 29)
     
  < Back