Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Perkin Elmer Storefronts  >  p53 Peptides  >>  p53 Tumor Suppressor (361-393), LC-Biotin, human

Product Name p53 Tumor Suppressor (361 - 393), LC - Biotin, human
Biotin - LC - GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD - NH2
Size 0.5 mg
Catalog # 62530
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is amino acids 361 to 393 fragment of p53 tumor suppressor protein. This sequence is biotinylated through the LC spacer on the N-terminus. p53 is a transcription factor that regulates cell cycle and functions as a tumor supressor.

Storage -20C
Molecular Weight 3992.6
Sequence
(One-Letter Code)
Biotin-LC-GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD-NH2
Sequence
(Three-Letter Code)
Biotin - LC - Gly - Ser - Arg - Ala - His - Ser - Ser - His - Leu - Lys - Ser - Lys - Lys - Gly - Gln - Ser - Thr - Ser - Arg - His - Lys - Lys - Leu - Met - Phe - Lys - Thr - Glu - Gly - Pro - Asp - Ser - Asp - NH2
     
  < Back