Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Endothelin  >>  Big Endothelin 1 (1-39), porcine

Product Name Big Endothelin 1 (1 - 39), porcine
CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1 - 15 and 3 - 11)
Size 1 mg
Catalog # AS-20715
US$ $583
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4384.1
Sequence
(One-Letter Code)
CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
Sequence
(Three-Letter Code)
H - Cys - Ser - Cys - Ser - Ser - Leu - Met - Asp - Lys - Glu - Cys - Val - Tyr - Phe - Cys - His - Leu - Asp - Ile - Ile - Trp - Val - Asn - Thr - Pro - Glu - His - Ile - Val - Pro - Tyr - Gly - Leu - Gly - Ser - Pro - Ser - Arg - Ser - OH
     
  < Back