Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Galanin-Lys(Biotin), human, FAM-labeled

Product Name	Galanin - Lys(Biotin), human, FAM - labeled
Size	1 mg
Catalog #	23621
US$	$423
Description	This is a N-terminus fluorescent (FAM)-labeled and C-terminus biotinylated Galanin peptide, Abs/Em=494/521nm.
Detailed Information	Material Safety Data Sheets (MSDS)
Storage	-20°C
Molecular Weight	3870.2
Sequence (One-Letter Code)	FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
Sequence (Three-Letter Code)	FAM - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - Lys(Biotin) - OH