Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Galanin  >>  Galanin-Lys(Biotin), human

Product Name Galanin - Lys(Biotin), human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
Size 0.5 mg
Catalog # 23638
US$ $253
Description

Biotin is attached to the epsilon group of the extra lysine added to the C-terminus of this Galanin.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 3511.9
Sequence
(One-Letter Code)
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
Sequence
(Three-Letter Code)
H - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - Lys(Biotin) - OH
     
  < Back