Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  GPCR Peptide Ligands  >  Gastrin  >>  Gastrin Releasing Peptide, human

Product Name Gastrin Releasing Peptide, human
Size 0.5 mg
Catalog # 24213
US$ $115
Description

Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Kamata, K. et al. Nephrol. Dialysis Transplantation 11, 1267 (1996); Tache, Y. et al. Gastroenterol. 81, 298 (1981); Siegfried, J. et al. J. Biol. Chem. 269, 8596 (1994); Patel, O. et al. Biochem. Pharmacol. 68, 2129 (2004).
Molecular Weight 2859.4
Sequence
(One-Letter Code)
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Sequence
(Three-Letter Code)
H - Val - Pro - Leu - Pro - Ala - Gly - Gly - Gly - Thr - Val - Leu - Thr - Lys - Met - Tyr - Pro - Arg - Gly - Asn - His - Trp - Ala - Val - Gly - His - Leu - Met - NH2
     
  < Back