Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  GPCR Peptide Ligands  >  Glucagon  >>  Glucagon-like Peptide-2, GLP-2 (146-178), human
Product Name Glucagon - like Peptide - 2, GLP - 2 (146 - 178), human
Size 1 mg
Catalog # 62070
US$ $281
Description

This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Cameron, H. et al. JPET 314, 214 (2005).
Molecular Weight 3766.2
Sequence
(One-Letter Code)		 HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Sequence
(Three-Letter Code)		 H - His - Ala - Asp - Gly - Ser - Phe - Ser - Asp - Glu - Met - Asn - Thr - Ile - Leu - Asp - Asn - Leu - Ala - Ala - Arg - Asp - Phe - Ile - Asn - Trp - Leu - Ile - Gln - Thr - Lys - Ile - Thr - Asp - OH
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions