Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Glucagon  >>  Glucagon (1-37), Oxyntomodulin, porcine

Product Name Glucagon (1 - 37), Oxyntomodulin, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Size 1 mg
Catalog # AS-22455
US$ $665
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4421.9
Sequence
(One-Letter Code)
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Sequence
(Three-Letter Code)
H - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - Lys - Arg - Asn - Lys - Asn - Asn - Ile - Ala - OH
     
  < Back